Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.304: TTHA1013/TTHA0281-like [143099] (1 superfamily) beta(3)-alpha-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other; topological similarity to the SEP domain fold (102847); dimerises via the long C-terminal strand with the formation of a single beta-sheet |
Superfamily d.304.1: TTHA1013/TTHA0281-like [143100] (2 families) |
Family d.304.1.2: TTHA0281-like [160109] (2 proteins) Pfam PF03681; UPF0150; alpha-beta(3)-alpha-X |
Protein automated matches [190611] (1 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [187633] (1 PDB entry) |
Domain d2dsyd_: 2dsy D: [146572] Other proteins in same PDB: d2dsya1 automated match to d2dsya1 complexed with mg, nhe |
PDB Entry: 2dsy (more details), 1.9 Å
SCOPe Domain Sequences for d2dsyd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dsyd_ d.304.1.2 (D:) automated matches {Thermus thermophilus [TaxId: 274]} gmgtltryleeamararyeliadeepyygeipdlpgvwatgkslkeceanlqaaledwll fllsrgetppplgevrielph
Timeline for d2dsyd_: