SCOPe 2.06: Domain d2doea1: 2doe A:784-853

Lineage for d2doea1 (2doe A:784-853)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.2: FF domain [81698] (1 family)

5. Family a.159.2.1: FF domain [81699] (4 proteins)

6. Protein Transcription elongation regulator 1 [158352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158353] (3 PDB entries)
   Uniprot O14776 651-719! Uniprot O14776 784-853! Uniprot O14776 888-959

8. Domain d2doea1: 2doe A:784-853 [146550]
   Other proteins in same PDB: d2doea2, d2doea3
   3rd FF domain

Details for d2doea1

PDB Entry: 2doe

PDB Description: solution structure of the third ff domain of human transcription factor ca150

PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2doea1:

Sequence; same for both SEQRES and ATOM records:

>d2doea1 a.159.2.1 (A:784-853) Transcription elongation regulator 1 {Human (Homo sapiens) [TaxId: 9606]}
ekedsktrgekiksdffellsnhhldsqsrwskvkdkvesdprykavdsssmredlfkqy
iekiaknlds

Timeline for d2doea1:

• d2doea1 first appeared in SCOP 1.75
  
• d2doea1 appears in SCOPe 2.05
  
• d2doea1 appears in SCOPe 2.07
  
• d2doea1 appears in the current release, SCOPe 2.08