Lineage for d2doea1 (2doe A:784-853)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348592Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2348609Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 2348610Family a.159.2.1: FF domain [81699] (4 proteins)
  6. 2348618Protein Transcription elongation regulator 1 [158352] (1 species)
  7. 2348619Species Human (Homo sapiens) [TaxId:9606] [158353] (3 PDB entries)
    Uniprot O14776 651-719! Uniprot O14776 784-853! Uniprot O14776 888-959
  8. 2348622Domain d2doea1: 2doe A:784-853 [146550]
    Other proteins in same PDB: d2doea2, d2doea3
    3rd FF domain

Details for d2doea1

PDB Entry: 2doe (more details)

PDB Description: solution structure of the third ff domain of human transcription factor ca150
PDB Compounds: (A:) Transcription elongation regulator 1

SCOPe Domain Sequences for d2doea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doea1 a.159.2.1 (A:784-853) Transcription elongation regulator 1 {Human (Homo sapiens) [TaxId: 9606]}
ekedsktrgekiksdffellsnhhldsqsrwskvkdkvesdprykavdsssmredlfkqy
iekiaknlds

SCOPe Domain Coordinates for d2doea1:

Click to download the PDB-style file with coordinates for d2doea1.
(The format of our PDB-style files is described here.)

Timeline for d2doea1: