SCOPe 2.06: Domain d2dkya1: 2dky A:8-85

Lineage for d2dkya1 (2dky A:8-85)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
   shares a sequence motif with Pfam PF07647, but has a distinct packing of helices

6. Protein Deleted in liver cancer 1 protein, DLC-1 [158529] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158530] (2 PDB entries)
   Uniprot Q96QB1 1-76! Uniprot Q96QB1 1-78

8. Domain d2dkya1: 2dky A:8-85 [146539]
   Other proteins in same PDB: d2dkya2, d2dkya3

Details for d2dkya1

PDB Entry: 2dky

PDB Description: solution structure of the sam-domain of rho-gtpase-activating protein 7

PDB Compounds: (A:) Rho-GTPase-activating protein 7

SCOPe Domain Sequences for d2dkya1:

Sequence; same for both SEQRES and ATOM records:

>d2dkya1 a.60.1.3 (A:8-85) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]}
mcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdfldrdaie
alcrrlntlnkcavmkle

Timeline for d2dkya1:

• d2dkya1 first appeared in SCOP 1.75
  
• d2dkya1 appears in SCOPe 2.05
  
• d2dkya1 appears in SCOPe 2.07
  
• d2dkya1 appears in the current release, SCOPe 2.08