Lineage for d2dkya1 (2dky A:8-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715562Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
    shares a sequence motif with Pfam PF07647, but has a distinct packing of helices
  6. 2715563Protein Deleted in liver cancer 1 protein, DLC-1 [158529] (1 species)
  7. 2715564Species Human (Homo sapiens) [TaxId:9606] [158530] (2 PDB entries)
    Uniprot Q96QB1 1-76! Uniprot Q96QB1 1-78
  8. 2715566Domain d2dkya1: 2dky A:8-85 [146539]
    Other proteins in same PDB: d2dkya2, d2dkya3

Details for d2dkya1

PDB Entry: 2dky (more details)

PDB Description: solution structure of the sam-domain of rho-gtpase-activating protein 7
PDB Compounds: (A:) Rho-GTPase-activating protein 7

SCOPe Domain Sequences for d2dkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkya1 a.60.1.3 (A:8-85) Deleted in liver cancer 1 protein, DLC-1 {Human (Homo sapiens) [TaxId: 9606]}
mcrkkpdtmiltqieakeacdwlratgfpqyaqlyedflfpidislvkrehdfldrdaie
alcrrlntlnkcavmkle

SCOPe Domain Coordinates for d2dkya1:

Click to download the PDB-style file with coordinates for d2dkya1.
(The format of our PDB-style files is described here.)

Timeline for d2dkya1: