![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein TTHA1254 [160640] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [160641] (2 PDB entries) Uniprot Q5SIW0 1-130 |
![]() | Domain d2d4oa1: 2d4o A:1-130 [146458] mutant |
PDB Entry: 2d4o (more details), 1.8 Å
SCOPe Domain Sequences for d2d4oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4oa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]} mrfrpfteedldrlnrlagkrpvslgalrffartghsflaeegeepmgfalaqavwqgea ttvlvtrmegrsvealrgllravvksaydagvyevalhldperkeleealkaegfalgpl vlavrvlgsr
Timeline for d2d4oa1: