SCOPe 2.03: Domain d2d4oa1: 2d4o A:1-130

Lineage for d2d4oa1 (2d4o A:1-130)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein TTHA1254 [160640] (1 species)

7. Species Thermus thermophilus [TaxId:274] [160641] (2 PDB entries)
   Uniprot Q5SIW0 1-130

8. Domain d2d4oa1: 2d4o A:1-130 [146458]
   mutant

Details for d2d4oa1

PDB Entry: 2d4o, 1.8 Å

PDB Description: crystal structure of ttha1254 (i68m mutant) from thermus thermophilus hb8

PDB Compounds: (A:) hypothetical protein TTHA1254

SCOPe Domain Sequences for d2d4oa1:

Sequence; same for both SEQRES and ATOM records:

>d2d4oa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]}
mrfrpfteedldrlnrlagkrpvslgalrffartghsflaeegeepmgfalaqavwqgea
ttvlvtrmegrsvealrgllravvksaydagvyevalhldperkeleealkaegfalgpl
vlavrvlgsr

Timeline for d2d4oa1:

• d2d4oa1 first appeared in SCOP 1.75
  
• d2d4oa1 appears in SCOPe 2.02
  
• d2d4oa1 appears in SCOPe 2.04
  
• d2d4oa1 appears in the current release, SCOPe 2.08