SCOPe 2.04: Domain d2d27a1: 2d27 A:1-148

Lineage for d2d27a1 (2d27 A:1-148)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family)
   contains extra C-terminal helix that packs against shorter N-terminal helix

5. Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
   Pfam PF05157 (also includes PfamB PB000210)

6. Protein Type II secretion ATPase XpsE [160248] (1 species)
   contains extra N-terminal alpha-helical subdomain, that can form swapped dimers

7. Species Xanthomonas campestris [TaxId:339] [160249] (2 PDB entries)
   Uniprot P31742 1-148! Uniprot P31742 1-149

8. Domain d2d27a1: 2d27 A:1-148 [146449]

Details for d2d27a1

PDB Entry: 2d27, 2.21 Å

PDB Description: Structure of the N-terminal domain of XpsE (crystal form I4122)

PDB Compounds: (A:) type II secretion ATPase XpsE

SCOPe Domain Sequences for d2d27a1:

Sequence; same for both SEQRES and ATOM records:

>d2d27a1 d.52.10.1 (A:1-148) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdllrarqlqaesgmgllallgrlglvserdhaetcae
vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
avrlatglplllhvglrseiddlierwy

Timeline for d2d27a1:

• d2d27a1 first appeared in SCOP 1.75
  
• d2d27a1 appears in SCOPe 2.03
  
• d2d27a1 appears in SCOPe 2.05
  
• d2d27a1 appears in the current release, SCOPe 2.08