Lineage for d2d27a1 (2d27 A:1-148)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1648684Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1648935Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) (S)
    contains extra C-terminal helix that packs against shorter N-terminal helix
  5. 1648936Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins)
    Pfam PF05157 (also includes PfamB PB000210)
  6. 1648940Protein Type II secretion ATPase XpsE [160248] (1 species)
    contains extra N-terminal alpha-helical subdomain, that can form swapped dimers
  7. 1648941Species Xanthomonas campestris [TaxId:339] [160249] (2 PDB entries)
    Uniprot P31742 1-148! Uniprot P31742 1-149
  8. 1648943Domain d2d27a1: 2d27 A:1-148 [146449]

Details for d2d27a1

PDB Entry: 2d27 (more details), 2.21 Å

PDB Description: Structure of the N-terminal domain of XpsE (crystal form I4122)
PDB Compounds: (A:) type II secretion ATPase XpsE

SCOPe Domain Sequences for d2d27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d27a1 d.52.10.1 (A:1-148) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]}
meqrsaetriveallerrrlkdtdllrarqlqaesgmgllallgrlglvserdhaetcae
vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid
avrlatglplllhvglrseiddlierwy

SCOPe Domain Coordinates for d2d27a1:

Click to download the PDB-style file with coordinates for d2d27a1.
(The format of our PDB-style files is described here.)

Timeline for d2d27a1: