![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.10: EspE N-terminal domain-like [160246] (1 family) ![]() contains extra C-terminal helix that packs against shorter N-terminal helix |
![]() | Family d.52.10.1: GSPII protein E N-terminal domain-like [160247] (3 proteins) Pfam PF05157 (also includes PfamB PB000210) |
![]() | Protein Type II secretion ATPase XpsE [160248] (1 species) contains extra N-terminal alpha-helical subdomain, that can form swapped dimers |
![]() | Species Xanthomonas campestris [TaxId:339] [160249] (2 PDB entries) Uniprot P31742 1-148! Uniprot P31742 1-149 |
![]() | Domain d2d27a1: 2d27 A:1-148 [146449] |
PDB Entry: 2d27 (more details), 2.21 Å
SCOPe Domain Sequences for d2d27a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d27a1 d.52.10.1 (A:1-148) Type II secretion ATPase XpsE {Xanthomonas campestris [TaxId: 339]} meqrsaetriveallerrrlkdtdllrarqlqaesgmgllallgrlglvserdhaetcae vlglplvdarqlgdtppemlpevqglslrflkqfhlcpvgerdgrldlwiadpyddyaid avrlatglplllhvglrseiddlierwy
Timeline for d2d27a1: