Lineage for d2cu9a1 (2cu9 A:1-161)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1112427Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
  5. 1112428Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1112429Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1112434Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries)
    Uniprot O74515 1-161
  8. 1112435Domain d2cu9a1: 2cu9 A:1-161 [146430]
    complexed with pg0

Details for d2cu9a1

PDB Entry: 2cu9 (more details), 1.8 Å

PDB Description: Crystal structure of Histone chaperone cia1
PDB Compounds: (A:) Histone chaperone cia1

SCOPe Domain Sequences for d2cu9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cu9a1 b.1.22.1 (A:1-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn

SCOPe Domain Coordinates for d2cu9a1:

Click to download the PDB-style file with coordinates for d2cu9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cu9a1: