| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.22: ASF1-like [101546] (1 family) ![]() contains extra C-terminal strand |
| Family b.1.22.1: ASF1-like [101547] (1 protein) |
| Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [158909] (4 PDB entries) Uniprot O74515 1-161 |
| Domain d2cu9a1: 2cu9 A:1-161 [146430] complexed with pg0 |
PDB Entry: 2cu9 (more details), 1.8 Å
SCOPe Domain Sequences for d2cu9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cu9a1 b.1.22.1 (A:1-161) Anti-silencing protein 1, ASF1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
msivnilsvnvlnnpakfsdpykfeitfecleplksdlewkltyvgsatsqsydqildtl
lvgpipiginkfvfeadppnidllpqlsdvlgvtvillscayednefvrvgyyvnnemeg
lnlqemddaeikkvkvdiskvwrsilaekprvtrfniqwdn
Timeline for d2cu9a1: