Lineage for d2csva1 (2csv A:8-66)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264031Fold g.43: B-box zinc-binding domain [57844] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 2264032Superfamily g.43.1: B-box zinc-binding domain [57845] (2 families) (S)
  5. 2264033Family g.43.1.1: B-box zinc-binding domain [57846] (8 proteins)
  6. 2264043Protein Tripartite motif-containing protein 29 [161194] (1 species)
  7. 2264044Species Human (Homo sapiens) [TaxId:9606] [161195] (1 PDB entry)
    Uniprot Q14134 212-270
  8. 2264045Domain d2csva1: 2csv A:8-66 [146424]
    Other proteins in same PDB: d2csva2, d2csva3
    complexed with zn

Details for d2csva1

PDB Entry: 2csv (more details)

PDB Description: solution structure of the zf-b_box type2 domain of human tripartite motif protein trim29 isoform alpha
PDB Compounds: (A:) Tripartite motif protein 29

SCOPe Domain Sequences for d2csva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]}
qllepirdfearkcpvhgktmelfcqtdqtcicylcmfqehknhstvtveeakaekete

SCOPe Domain Coordinates for d2csva1:

Click to download the PDB-style file with coordinates for d2csva1.
(The format of our PDB-style files is described here.)

Timeline for d2csva1: