![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.43: B-box zinc-binding domain [57844] (1 superfamily) zinc-bound alpha+beta motif |
![]() | Superfamily g.43.1: B-box zinc-binding domain [57845] (1 family) ![]() |
![]() | Family g.43.1.1: B-box zinc-binding domain [57846] (7 proteins) |
![]() | Protein Tripartite motif-containing protein 29 [161194] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161195] (1 PDB entry) Uniprot Q14134 212-270 |
![]() | Domain d2csva1: 2csv A:8-66 [146424] complexed with zn |
PDB Entry: 2csv (more details)
SCOP Domain Sequences for d2csva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} qllepirdfearkcpvhgktmelfcqtdqtcicylcmfqehknhstvtveeakaekete
Timeline for d2csva1: