![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187268] (5 PDB entries) |
![]() | Domain d2c44b_: 2c44 B: [146372] Other proteins in same PDB: d2c44a1 automated match to d1ax4a_ complexed with k, so4 |
PDB Entry: 2c44 (more details), 2.81 Å
SCOPe Domain Sequences for d2c44b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c44b_ c.67.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev
Timeline for d2c44b_: