Lineage for d2c44c_ (2c44 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897121Species Escherichia coli [TaxId:562] [187268] (5 PDB entries)
  8. 2897127Domain d2c44c_: 2c44 C: [146373]
    Other proteins in same PDB: d2c44a1
    automated match to d1ax4a_
    complexed with k, so4

Details for d2c44c_

PDB Entry: 2c44 (more details), 2.81 Å

PDB Description: crystal structure of e. coli tryptophanase
PDB Compounds: (C:) tryptophanase

SCOPe Domain Sequences for d2c44c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c44c_ c.67.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
fkhlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsm
qaammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgl
drskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieev
gpnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqrea
eykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqeg
fptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvd
agkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltip
ratytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev

SCOPe Domain Coordinates for d2c44c_:

Click to download the PDB-style file with coordinates for d2c44c_.
(The format of our PDB-style files is described here.)

Timeline for d2c44c_: