Lineage for d2c44a1 (2c44 A:5-471)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131389Family c.67.1.2: Beta-eliminating lyases [53397] (3 protein domains)
  6. 2131390Protein Tryptophan indol-lyase (tryptophanase) [53400] (2 species)
  7. 2131391Species Escherichia coli [TaxId:562] [159703] (7 PDB entries)
    Uniprot P0A853 5-471! Uniprot Q8XB34 5-471
  8. 2131396Domain d2c44a1: 2c44 A:5-471 [146371]
    Other proteins in same PDB: d2c44b_, d2c44c_, d2c44d_
    complexed with k, so4

Details for d2c44a1

PDB Entry: 2c44 (more details), 2.81 Å

PDB Description: crystal structure of e. coli tryptophanase
PDB Compounds: (A:) tryptophanase

SCOPe Domain Sequences for d2c44a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c44a1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]}
khlpepfrirviepvkrttrayreeaiiksgmnpflldsedvfidlltdsgtgavtqsmq
aammrgdeaysgsrsyyalaesvknifgyqytipthqgrgaeqiyipvlikkreqekgld
rskmvafsnyffdttqghsqingctvrnvyikeafdtgvrydfkgnfdleglergieevg
pnnvpyivatitsnsaggqpvslanlkamysiakkydipvvmdsarfaenayfikqreae
ykdwtieqitretykyadmlamsakkdamvpmggllcmkddsffdvytecrtlcvvqegf
ptyggleggamerlavglydgmnldwlayriaqvqylvdgleeigvvcqqagghaafvda
gkllphipadqfpaqalacelykvagiraveigsfllgrdpktgkqlpcpaellrltipr
atytqthmdfiieafkhvkenasnikgltftyepkvlrhftaklkev

SCOPe Domain Coordinates for d2c44a1:

Click to download the PDB-style file with coordinates for d2c44a1.
(The format of our PDB-style files is described here.)

Timeline for d2c44a1: