![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins) |
![]() | Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160591] (9 PDB entries) Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248 |
![]() | Domain d2c37n2: 2c37 N:156-248 [146255] Other proteins in same PDB: d2c37a1, d2c37a2, d2c37b1, d2c37c1, d2c37c2, d2c37d1, d2c37e1, d2c37e2, d2c37f1, d2c37g1, d2c37g2, d2c37h1, d2c37i1, d2c37i2, d2c37j1, d2c37k1, d2c37k2, d2c37l1, d2c37m1, d2c37m2, d2c37n1, d2c37o1, d2c37o2, d2c37p1, d2c37q1, d2c37q2, d2c37r1, d2c37s1, d2c37s2, d2c37t1, d2c37u1, d2c37u2, d2c37v1, d2c37w1, d2c37w2, d2c37x1 automated match to d2br2b2 protein/RNA complex; complexed with cl, na, rp5, u5p |
PDB Entry: 2c37 (more details), 2.8 Å
SCOPe Domain Sequences for d2c37n2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c37n2 d.101.1.1 (N:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr qafdlavkginiiynlerealkskyvefkeegv
Timeline for d2c37n2:
![]() Domains from other chains: (mouse over for more information) d2c37a1, d2c37a2, d2c37b1, d2c37b2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37e1, d2c37e2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37i1, d2c37i2, d2c37j1, d2c37j2, d2c37k1, d2c37k2, d2c37l1, d2c37l2, d2c37m1, d2c37m2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2 |