Lineage for d2c37m1 (2c37 M:1-191)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930318Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)
  6. 2930461Protein automated matches [232811] (2 species)
    not a true protein
  7. 2930469Species Sulfolobus solfataricus [TaxId:2287] [232812] (4 PDB entries)
  8. 2930488Domain d2c37m1: 2c37 M:1-191 [146252]
    Other proteins in same PDB: d2c37a2, d2c37b1, d2c37b2, d2c37c2, d2c37d1, d2c37d2, d2c37e2, d2c37f1, d2c37f2, d2c37g2, d2c37h1, d2c37h2, d2c37i2, d2c37j1, d2c37j2, d2c37k2, d2c37l1, d2c37l2, d2c37m2, d2c37n1, d2c37n2, d2c37o2, d2c37p1, d2c37p2, d2c37q2, d2c37r1, d2c37r2, d2c37s2, d2c37t1, d2c37t2, d2c37u2, d2c37v1, d2c37v2, d2c37w2, d2c37x1, d2c37x2
    automated match to d2je6a1
    protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37m1

PDB Entry: 2c37 (more details), 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna
PDB Compounds: (M:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c37m1:

Sequence, based on SEQRES records: (download)

>d2c37m1 d.14.1.4 (M:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
svnknevvgkl

Sequence, based on observed residues (ATOM records): (download)

>d2c37m1 d.14.1.4 (M:1-191) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgkl

SCOPe Domain Coordinates for d2c37m1:

Click to download the PDB-style file with coordinates for d2c37m1.
(The format of our PDB-style files is described here.)

Timeline for d2c37m1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c37m2
View in 3D
Domains from other chains:
(mouse over for more information)
d2c37a1, d2c37a2, d2c37b1, d2c37b2, d2c37c1, d2c37c2, d2c37d1, d2c37d2, d2c37e1, d2c37e2, d2c37f1, d2c37f2, d2c37g1, d2c37g2, d2c37h1, d2c37h2, d2c37i1, d2c37i2, d2c37j1, d2c37j2, d2c37k1, d2c37k2, d2c37l1, d2c37l2, d2c37n1, d2c37n2, d2c37o1, d2c37o2, d2c37p1, d2c37p2, d2c37q1, d2c37q2, d2c37r1, d2c37r2, d2c37s1, d2c37s2, d2c37t1, d2c37t2, d2c37u1, d2c37u2, d2c37v1, d2c37v2, d2c37w1, d2c37w2, d2c37x1, d2c37x2