SCOPe 2.08: Domain d2c37m2: 2c37 M:192-275

Lineage for d2c37m2 (2c37 M:192-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.0: automated matches [227218] (1 protein)
   not a true family

6. Protein automated matches [226956] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [232814] (4 PDB entries)

8. Domain d2c37m2: 2c37 M:192-275 [146253]
   Other proteins in same PDB: d2c37a1, d2c37b1, d2c37b2, d2c37c1, d2c37d1, d2c37d2, d2c37e1, d2c37f1, d2c37f2, d2c37g1, d2c37h1, d2c37h2, d2c37i1, d2c37j1, d2c37j2, d2c37k1, d2c37l1, d2c37l2, d2c37m1, d2c37n1, d2c37n2, d2c37o1, d2c37p1, d2c37p2, d2c37q1, d2c37r1, d2c37r2, d2c37s1, d2c37t1, d2c37t2, d2c37u1, d2c37v1, d2c37v2, d2c37w1, d2c37x1, d2c37x2
   automated match to d2je6a2
   protein/RNA complex; complexed with cl, na, rp5, u5p

Details for d2c37m2

PDB Entry: 2c37, 2.8 Å

PDB Description: rnase ph core of the archaeal exosome in complex with u8 rna

PDB Compounds: (M:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c37m2:

Sequence; same for both SEQRES and ATOM records:

>d2c37m2 d.101.1.0 (M:192-275) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlgi

Timeline for d2c37m2:

• d2c37m2 first appeared in SCOP 1.75
  
• d2c37m2 appears in SCOPe 2.07