SCOPe 2.01: Domain d1zwzb1: 1zwz B:4-128

Lineage for d1zwzb1 (1zwz B:4-128)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Small nuclear ribonucleoprotein-associated protein 1, Snu13p [160504] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160505] (2 PDB entries)
   Uniprot P39990 1-126! Uniprot P39990 2-126

8. Domain d1zwzb1: 1zwz B:4-128 [146032]
   automatically matched to 1ZWZ A:4-128
   protein/RNA complex

Details for d1zwzb1

PDB Entry: 1zwz, 1.9 Å

PDB Description: structural comparison of yeast snornp and splicesomal protein snu13p with its homologs

PDB Compounds: (B:) Snu13p

SCOPe Domain Sequences for d1zwzb1:

Sequence; same for both SEQRES and ATOM records:

>d1zwzb1 d.79.3.1 (B:4-128) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcepi
eillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdki
etlli

Timeline for d1zwzb1:

• d1zwzb1 first appeared in SCOP 1.75
  
• d1zwzb1 appears in SCOPe 2.02
  
• d1zwzb1 appears in the current release, SCOPe 2.08