Lineage for d1zwzb1 (1zwz B:4-128)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.3: L30e-like [55315] (4 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) 
Protein Small nuclear ribonucleoprotein-associated protein 1, Snu13p [160504] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160505] (2 PDB entries)
Uniprot P39990 1-126! Uniprot P39990 2-126
Domain d1zwzb1: 1zwz B:4-128 [146032]
automatically matched to 1ZWZ A:4-128
protein/RNA complex
Details for d1zwzb1
PDB Entry: 1zwz (more details), 1.9 Å
PDB Description: structural comparison of yeast snornp and splicesomal protein snu13p with its homologs
PDB Compounds: (B:) Snu13pSCOPe Domain Sequences for d1zwzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwzb1 d.79.3.1 (B:4-128) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcepi
eillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdki
etlli
SCOPe Domain Coordinates for d1zwzb1:
Click to download the PDB-style file with coordinates for d1zwzb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zwzb1:
- d1zwzb1 first appeared in SCOP 1.75
- d1zwzb1 appears in SCOPe 2.07
View in 3D
