Lineage for d1zwzb1 (1zwz B:4-128)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960194Protein Small nuclear ribonucleoprotein-associated protein 1, Snu13p [160504] (1 species)
  7. 2960195Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160505] (2 PDB entries)
    Uniprot P39990 1-126! Uniprot P39990 2-126
  8. 2960198Domain d1zwzb1: 1zwz B:4-128 [146032]
    automatically matched to 1ZWZ A:4-128
    protein/RNA complex

Details for d1zwzb1

PDB Entry: 1zwz (more details), 1.9 Å

PDB Description: structural comparison of yeast snornp and splicesomal protein snu13p with its homologs
PDB Compounds: (B:) Snu13p

SCOPe Domain Sequences for d1zwzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwzb1 d.79.3.1 (B:4-128) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sapnpkafpladaaltqqildvvqqaanlrqlkkganeatktlnrgisefiimaadcepi
eillhlpllcedknvpyvfvpsrvalgracgvsrpviaasittndasaiktqiyavkdki
etlli

SCOPe Domain Coordinates for d1zwzb1:

Click to download the PDB-style file with coordinates for d1zwzb1.
(The format of our PDB-style files is described here.)

Timeline for d1zwzb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zwza1