Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family) consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail |
Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein) Pfam PF00466; covers globular domain only |
Protein Ribosomal protein L10 [160371] (1 species) see also (64661) for a partial structure in the ribosome |
Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries) Uniprot P29394 1-177 |
Domain d1zaxa1: 1zax A:4-177 [145976] Other proteins in same PDB: d1zaxu1, d1zaxv1, d1zaxw1, d1zaxx1, d1zaxy1, d1zaxz1 automatically matched to 1ZAV A:1-177 protein/RNA complex |
PDB Entry: 1zax (more details), 2.1 Å
SCOPe Domain Sequences for d1zaxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaxa1 d.58.62.1 (A:4-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]} rqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkntlln lalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggflegkkf taeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk
Timeline for d1zaxa1: