Lineage for d1zaxa1 (1zax A:4-177)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1030511Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family) (S)
    consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail
  5. 1030512Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein)
    Pfam PF00466; covers globular domain only
  6. 1030513Protein Ribosomal protein L10 [160371] (1 species)
    see also (64661) for a partial structure in the ribosome
  7. 1030514Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries)
    Uniprot P29394 1-177
  8. 1030516Domain d1zaxa1: 1zax A:4-177 [145976]
    Other proteins in same PDB: d1zaxu1, d1zaxv1, d1zaxw1, d1zaxx1, d1zaxy1, d1zaxz1
    automatically matched to 1ZAV A:1-177
    protein/RNA complex

Details for d1zaxa1

PDB Entry: 1zax (more details), 2.1 Å

PDB Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form B
PDB Compounds: (A:) 50s ribosomal protein l10

SCOPe Domain Sequences for d1zaxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaxa1 d.58.62.1 (A:4-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]}
rqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkntlln
lalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggflegkkf
taeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk

SCOPe Domain Coordinates for d1zaxa1:

Click to download the PDB-style file with coordinates for d1zaxa1.
(The format of our PDB-style files is described here.)

Timeline for d1zaxa1: