SCOP 1.75: Domain d1zaxa1: 1zax A:4-177

Lineage for d1zaxa1 (1zax A:4-177)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.62: Ribosomal protein L10-like [160369] (1 family)
   consists of globular N-terminal domain, structurally similar to NDK, and the L7/L12-binding C-terminal alpha-helical tail

5. Family d.58.62.1: Ribosomal protein L10-like [160370] (1 protein)
   Pfam PF00466; covers globular domain only

6. Protein Ribosomal protein L10 [160371] (1 species)
   see also (64661) for a partial structure in the ribosome
   see also (64661) for a partial structure in the ribosome

7. Species Thermotoga maritima [TaxId:2336] [160372] (3 PDB entries)
   Uniprot P29394 1-177

8. Domain d1zaxa1: 1zax A:4-177 [145976]
   Other proteins in same PDB: d1zaxu1, d1zaxv1, d1zaxw1, d1zaxx1, d1zaxy1, d1zaxz1
   automatically matched to 1ZAV A:1-177

Details for d1zaxa1

PDB Entry: 1zax, 2.1 Å

PDB Description: Ribosomal Protein L10-L12(NTD) Complex, Space Group P212121, Form B

PDB Compounds: (A:) 50s ribosomal protein l10

SCOP Domain Sequences for d1zaxa1:

Sequence; same for both SEQRES and ATOM records:

>d1zaxa1 d.58.62.1 (A:4-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]}
rqqkelivkemseifkktslilfadflgftvadltelrsrlrekygdgarfrvvkntlln
lalknaeyegyeeflkgptavlyvtegdpveavkiiynfykdkkadlsrlkggflegkkf
taeeveniaklpskeelyamlvgrvkapitglvfalsgilrnlvyvlnaikekk

Timeline for d1zaxa1:

• d1zaxa1 is new in SCOP 1.75
  
• d1zaxa1 appears in SCOPe 2.01
  
• d1zaxa1 appears in the current release, SCOPe 2.08