![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species) duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [161129] (7 PDB entries) Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108 |
![]() | Domain d1ywhg1: 1ywh G:92-188 [145934] automated match to d1ywha1 complexed with nag, so4 |
PDB Entry: 1ywh (more details), 2.7 Å
SCOPe Domain Sequences for d1ywhg1:
Sequence, based on SEQRES records: (download)
>d1ywhg1 g.7.1.3 (G:92-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]} yleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgylp gcpgsngfhnndtfhflkccnttkcnegpilelenlp
>d1ywhg1 g.7.1.3 (G:92-188) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]} yleciscgssdmscergrhqslqcrspeeqcldvvthwiqekddrhlrgcgylpgcpgsn gfhnndtfhflkccnttkcnegpilelenlp
Timeline for d1ywhg1: