Lineage for d1ywhk2 (1ywh K:1-78)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032435Protein Urokinase plasminogen activator surface receptor uPAR [161128] (1 species)
    duplication: tandem repeat of three similar domains; the N-terminal and C-terminal domains belong to Pfam PF00021; uPAR/Ly6
  7. 3032436Species Human (Homo sapiens) [TaxId:9606] [161129] (7 PDB entries)
    Uniprot Q03405 109-209! Uniprot Q03405 210-299! Uniprot Q03405 23-108
  8. 3032459Domain d1ywhk2: 1ywh K:1-78 [145941]
    automated match to d1ywha2
    complexed with nag, so4

Details for d1ywhk2

PDB Entry: 1ywh (more details), 2.7 Å

PDB Description: crystal structure of urokinase plasminogen activator receptor
PDB Compounds: (K:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d1ywhk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywhk2 g.7.1.3 (K:1-78) Urokinase plasminogen activator surface receptor uPAR {Human (Homo sapiens) [TaxId: 9606]}
lrcmqcktngdcrveecalgqdlcrttivrlweegeelelvekscthsektnrtlsyrtg
lkitsltevvcgldlcnq

SCOPe Domain Coordinates for d1ywhk2:

Click to download the PDB-style file with coordinates for d1ywhk2.
(The format of our PDB-style files is described here.)

Timeline for d1ywhk2: