Lineage for d1x2gb1 (1x2g B:247-337)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1945491Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 1945492Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 1945529Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
    automatically mapped to Pfam PF10437
  6. 1945533Protein Two-domain LplA, C-terminal domain [160211] (1 species)
  7. 1945534Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
    Uniprot P32099 247-337
  8. 1945537Domain d1x2gb1: 1x2g B:247-337 [145842]
    Other proteins in same PDB: d1x2ga2, d1x2gb2, d1x2gc2
    automated match to d1x2ga1

Details for d1x2gb1

PDB Entry: 1x2g (more details), 2.4 Å

PDB Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli
PDB Compounds: (B:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2gb1 d.224.1.3 (B:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

SCOPe Domain Coordinates for d1x2gb1:

Click to download the PDB-style file with coordinates for d1x2gb1.
(The format of our PDB-style files is described here.)

Timeline for d1x2gb1: