![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
![]() | Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
![]() | Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins) automatically mapped to Pfam PF10437 |
![]() | Protein Two-domain LplA, C-terminal domain [160211] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [160212] (5 PDB entries) Uniprot P32099 247-337 |
![]() | Domain d1x2ga1: 1x2g A:247-337 [145840] Other proteins in same PDB: d1x2ga2, d1x2gb2, d1x2gc2 |
PDB Entry: 1x2g (more details), 2.4 Å
SCOPe Domain Sequences for d1x2ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2ga1 d.224.1.3 (A:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]} qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm lqqeceallvdfpeqekelrelsawmagavr
Timeline for d1x2ga1:
![]() Domains from other chains: (mouse over for more information) d1x2gb1, d1x2gb2, d1x2gc1, d1x2gc2 |