SCOPe 2.08: Domain d1x2gb1: 1x2g B:247-337

Lineage for d1x2gb1 (1x2g B:247-337)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
   automatically mapped to Pfam PF10437

6. Protein Two-domain LplA, C-terminal domain [160211] (1 species)

7. Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
   Uniprot P32099 247-337

8. Domain d1x2gb1: 1x2g B:247-337 [145842]
   Other proteins in same PDB: d1x2ga2, d1x2gb2, d1x2gc2
   automated match to d1x2ga1

Details for d1x2gb1

PDB Entry: 1x2g, 2.4 Å

PDB Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli

PDB Compounds: (B:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2gb1:

Sequence; same for both SEQRES and ATOM records:

>d1x2gb1 d.224.1.3 (B:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

Timeline for d1x2gb1:

• d1x2gb1 first appeared in SCOP 1.75
  
• d1x2gb1 appears in SCOPe 2.07