SCOPe 2.08: Domain d1wrua2: 1wru A:3-176

Lineage for d1wrua2 (1wru A:3-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (4 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (4 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate protein gpP, N-terminal domain [418926] (3 species)
   43 kda tail protein; Pfam PF06893

7. Species Bacteriophage Mu [TaxId:10677] [419354] (1 PDB entry)
   Uniprot P08558

8. Domain d1wrua2: 1wru A:3-176 [145832]
   Other proteins in same PDB: d1wrua1
   has additional insertions and/or extensions that are not grouped together

Details for d1wrua2

PDB Entry: 1wru, 2.1 Å

PDB Description: Structure of central hub elucidated by X-ray analysis of gene product 44; baseplate component of bacteriophage Mu

PDB Compounds: (A:) 43 kDa tail protein

SCOPe Domain Sequences for d1wrua2:

Sequence; same for both SEQRES and ATOM records:

>d1wrua2 b.106.1.1 (A:3-176) Baseplate protein gpP, N-terminal domain {Bacteriophage Mu [TaxId: 10677]}
ntvtlradgrlftgwtsvsvtrsiesvagyfelgvnvppgtdlsglapgkkftleiggqi
vctgyidsrrrqmtadsmkitvagrdktadlidcaavysggqwknrtleqiardlcapyg
vtvrwelsdkessaafpgftldhsetvyealvrasrargvlmtsnaagelvfsr

Timeline for d1wrua2:

• d1wrua2 first appeared in SCOP 1.75
  
• d1wrua2 appears in SCOPe 2.07