PDB entry 1wru

View 1wru on RCSB PDB site
Description: Structure of central hub elucidated by X-ray analysis of gene product 44; baseplate component of bacteriophage Mu
Class: structural protein
Keywords: bacteriophage mu, baseplate, gene product 44, structural protein
Deposited on 2004-10-27, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.222
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 43 kDa tail protein
    Species: Enterobacteria phage Mu [TaxId:10677]
    Gene: 44
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wrua1, d1wrua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wruA (A:)
    msntvtlradgrlftgwtsvsvtrsiesvagyfelgvnvppgtdlsglapgkkftleigg
    qivctgyidsrrrqmtadsmkitvagrdktadlidcaavysggqwknrtleqiardlcap
    ygvtvrwelsdkessaafpgftldhsetvyealvrasrargvlmtsnaagelvfsraast
    atdelvlgenlltldfeedfrdrfseytvkgyarangaegddidaksivsrkgtatdsdv
    tryrpmiiiadskitakdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnllvti
    daskyaikttellvskvtlilndqdglktrvslapregflvpvesdrknrkggdsnggid
    alvedyyrrhpektppwke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wruA (A:)
    ntvtlradgrlftgwtsvsvtrsiesvagyfelgvnvppgtdlsglapgkkftleiggqi
    vctgyidsrrrqmtadsmkitvagrdktadlidcaavysggqwknrtleqiardlcapyg
    vtvrwelsdkessaafpgftldhsetvyealvrasrargvlmtsnaagelvfsraastat
    delvlgenlltldfeedfrdrfseytvksrkgtatdsdvtryrpmiiiadskitakdaqa
    ralreqrrrlaksitfeaeidgwtrkdgqlwmpnllvtidaskyaikttellvskvtlil
    ndqdglktrvslapregflvpvesd