![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
![]() | Superfamily b.106.1: Phage tail proteins [69279] (4 families) ![]() |
![]() | Family b.106.1.1: Baseplate protein-like [69280] (4 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
![]() | Protein Baseplate protein gpP, C-terminal domain [418927] (3 species) 43 kda tail protein; Pfam PF06893 |
![]() | Species Bacteriophage Mu [TaxId:10677] [419355] (1 PDB entry) Uniprot P08558 |
![]() | Domain d1wrua1: 1wru A:177-346 [145831] Other proteins in same PDB: d1wrua2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1wru (more details), 2.1 Å
SCOPe Domain Sequences for d1wrua1:
Sequence, based on SEQRES records: (download)
>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP, C-terminal domain {Bacteriophage Mu [TaxId: 10677]} aastatdelvlgenlltldfeedfrdrfseytvkgyarangaegddidaksivsrkgtat dsdvtryrpmiiiadskitakdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnl lvtidaskyaikttellvskvtlilndqdglktrvslapregflvpvesd
>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP, C-terminal domain {Bacteriophage Mu [TaxId: 10677]} aastatdelvlgenlltldfeedfrdrfseytvksrkgtatdsdvtryrpmiiiadskit akdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnllvtidaskyaikttellvs kvtlilndqdglktrvslapregflvpvesd
Timeline for d1wrua1: