SCOPe 2.02: Domain d2pkgd1: 2pkg D:91-170

Lineage for d2pkgd1 (2pkg D:91-170)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.92: T-antigen specific domain-like [161239] (1 superfamily)
   all-alpha zinc-binding domain; there are two zinc ion-binding sites with a common CxCxxC motif but different fourth ligands

4. Superfamily g.92.1: T-antigen specific domain-like [161240] (1 family)

5. Family g.92.1.1: T-antigen specific domain-like [161241] (1 protein)
   Pfam PF02380

6. Protein Small t antigen, ST-AG [161242] (1 species)

7. Species Simian virus 40 [TaxId:10633] [161243] (1 PDB entry)
   Uniprot P03081 91-170

8. Domain d2pkgd1: 2pkg D:91-170 [145747]
   Other proteins in same PDB: d2pkga1, d2pkgb1
   automatically matched to 2PKG C:91-170
   complexed with zn

Details for d2pkgd1

PDB Entry: 2pkg, 3.3 Å

PDB Description: Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40

PDB Compounds: (D:) Small T antigen

SCOPe Domain Sequences for d2pkgd1:

Sequence; same for both SEQRES and ATOM records:

>d2pkgd1 g.92.1.1 (D:91-170) Small t antigen, ST-AG {Simian virus 40 [TaxId: 10633]}
gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl
dlcegtlllwcdiigqttyr

Timeline for d2pkgd1:

• d2pkgd1 first appeared in SCOP 1.75
  
• d2pkgd1 appears in SCOPe 2.01
  
• d2pkgd1 appears in SCOPe 2.03
  
• d2pkgd1 appears in the current release, SCOPe 2.08