Lineage for d2pkgd1 (2pkg D:91-170)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894726Fold g.92: T-antigen specific domain-like [161239] (1 superfamily)
    all-alpha zinc-binding domain; there are two zinc ion-binding sites with a common CxCxxC motif but different fourth ligands
  4. 894727Superfamily g.92.1: T-antigen specific domain-like [161240] (1 family) (S)
  5. 894728Family g.92.1.1: T-antigen specific domain-like [161241] (1 protein)
    Pfam PF02380
  6. 894729Protein Small t antigen, ST-AG [161242] (1 species)
  7. 894730Species Simian virus 40 [TaxId:10633] [161243] (1 PDB entry)
    Uniprot P03081 91-170
  8. 894732Domain d2pkgd1: 2pkg D:91-170 [145747]
    Other proteins in same PDB: d2pkga1, d2pkgb1
    automatically matched to 2PKG C:91-170
    complexed with zn

Details for d2pkgd1

PDB Entry: 2pkg (more details), 3.3 Å

PDB Description: Structure of a complex between the A subunit of protein phosphatase 2A and the small t antigen of SV40
PDB Compounds: (D:) Small T antigen

SCOP Domain Sequences for d2pkgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkgd1 g.92.1.1 (D:91-170) Small t antigen, ST-AG {Simian virus 40 [TaxId: 10633]}
gvdamyckqwpecakkmsancicllcllrmkhenrklyrkdplvwvdcycfdcfrmwfgl
dlcegtlllwcdiigqttyr

SCOP Domain Coordinates for d2pkgd1:

Click to download the PDB-style file with coordinates for d2pkgd1.
(The format of our PDB-style files is described here.)

Timeline for d2pkgd1: