Lineage for d2ozlc_ (2ozl C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1593108Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 1593142Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 1593143Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)
  8. 1593149Domain d2ozlc_: 2ozl C: [145745]
    Other proteins in same PDB: d2ozlb1, d2ozlb2, d2ozld1, d2ozld2
    automated match to d1ni4a_
    complexed with k, mg, tpp

Details for d2ozlc_

PDB Entry: 2ozl (more details), 1.9 Å

PDB Description: human pyruvate dehydrogenase s264e variant
PDB Compounds: (C:) Pyruvate dehydrogenase E1 component alpha subunit, somatic form

SCOPe Domain Sequences for d2ozlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozlc_ c.36.1.11 (C:) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
sfandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiir
gfchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakg
kggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeay
nmaalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrf
aaaycrsgkgpilmelqtyryhghemsdpgvsyrtreeiqevrsksdpimllkdrmvnsn
lasveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfks
vs

SCOPe Domain Coordinates for d2ozlc_:

Click to download the PDB-style file with coordinates for d2ozlc_.
(The format of our PDB-style files is described here.)

Timeline for d2ozlc_: