Lineage for d2ozlc1 (2ozl C:1-361)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 829269Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 829311Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 829312Species Human (Homo sapiens) [TaxId:9606] [89652] (2 PDB entries)
  8. 829314Domain d2ozlc1: 2ozl C:1-361 [145745]
    Other proteins in same PDB: d2ozlb1, d2ozlb2, d2ozld1, d2ozld2
    automatically matched to 2OZL A:1-361
    complexed with k, mg, tpp; mutant

Details for d2ozlc1

PDB Entry: 2ozl (more details), 1.9 Å

PDB Description: Human pyruvate dehydrogenase S264E variant
PDB Compounds: (C:) Pyruvate dehydrogenase E1 component alpha subunit, somatic form

SCOP Domain Sequences for d2ozlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozlc1 c.36.1.11 (C:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghemsdpgvsyrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

SCOP Domain Coordinates for d2ozlc1:

Click to download the PDB-style file with coordinates for d2ozlc1.
(The format of our PDB-style files is described here.)

Timeline for d2ozlc1: