Lineage for d2nppf1 (2npp F:6-293)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876798Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 876799Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 876853Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)
  6. 876859Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 876860Species Human (Homo sapiens) [TaxId:9606] [143934] (7 PDB entries)
    Uniprot P67775 2-294
  8. 876867Domain d2nppf1: 2npp F:6-293 [145693]
    Other proteins in same PDB: d2nppa1, d2nppb1, d2nppd1, d2nppe1
    automatically matched to 2IE4 C:6-293
    complexed with acb, add, cab, mn

Details for d2nppf1

PDB Entry: 2npp (more details), 3.3 Å

PDB Description: Structure of the Protein Phosphatase 2A Holoenzyme
PDB Compounds: (F:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOP Domain Sequences for d2nppf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nppf1 d.159.1.3 (F:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
ftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfhdl
melfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqitq
vygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiraldr
lqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahqlvm
egynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

SCOP Domain Coordinates for d2nppf1:

Click to download the PDB-style file with coordinates for d2nppf1.
(The format of our PDB-style files is described here.)

Timeline for d2nppf1: