Lineage for d2nppe1 (2npp E:28-415)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775547Family a.118.1.20: B56-like [140819] (1 protein)
    Pfam PF01603; Protein phosphatase 2A regulatory B subunit family
  6. 775548Protein Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma [140820] (1 species)
  7. 775549Species Human (Homo sapiens) [TaxId:9606] [140821] (4 PDB entries)
    Uniprot Q13362 30-372! Uniprot Q13362 38-425
  8. 775552Domain d2nppe1: 2npp E:28-415 [138447]
    Other proteins in same PDB: d2nppa1, d2nppc1, d2nppd1, d2nppf1
    automatically matched to 2NPP B:28-415
    complexed with acb, add, cab, mn

Details for d2nppe1

PDB Entry: 2npp (more details), 3.3 Å

PDB Description: Structure of the Protein Phosphatase 2A Holoenzyme
PDB Compounds: (E:) serine/threonine-protein phosphatase 2a 56 kda regulatory subunit gamma isoform

SCOP Domain Sequences for d2nppe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nppe1 a.118.1.20 (E:28-415) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]}
qeklfiqklrqccvlfdfvsdplsdlkwkevkraalsemveyithnrnvitepiypevvh
mfavnmfrtlppssnptgaefdpeedeptleaawphlqlvyefflrflespdfqpniakk
yidqkfvlqllelfdsedprerdflkttlhriygkflglrayirkqinnifyrfiyeteh
hngiaelleilgsiingfalplkeehkifllkvllplhkvkslsvyhpqlaycvvqflek
dstltepvvmallkywpkthspkevmflneleeildviepsefvkimeplfrqlakcvss
phfqvaeralyywnneyimslisdnaakilpimfpslyrnskthwnktihgliynalklf
memnqklfddctqqfkaeklkeklkmke

SCOP Domain Coordinates for d2nppe1:

Click to download the PDB-style file with coordinates for d2nppe1.
(The format of our PDB-style files is described here.)

Timeline for d2nppe1: