Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
Protein Ribosomal protein L32p [144201] (3 species) |
Species Thermus thermophilus [TaxId:274] [161177] (7 PDB entries) Uniprot P80339 1-59 |
Domain d2j0151: 2j01 5:2-60 [145560] Other proteins in same PDB: d2j0111, d2j0121, d2j0131, d2j0141, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 Representative structure protein/RNA complex |
PDB Entry: 2j01 (more details), 2.8 Å
SCOPe Domain Sequences for d2j0151:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
Timeline for d2j0151:
View in 3D Domains from other chains: (mouse over for more information) d2j0111, d2j0121, d2j0131, d2j0141, d2j0161, d2j0171, d2j0181, d2j01c1, d2j01d1, d2j01d2, d2j01e1, d2j01f1, d2j01g1, d2j01h1, d2j01h2, d2j01i1, d2j01i2, d2j01n1, d2j01o1, d2j01p1, d2j01q1, d2j01r1, d2j01s1, d2j01t1, d2j01u1, d2j01v1, d2j01w1, d2j01x1, d2j01y1, d2j01z1 |