Lineage for d2izva2 (2izv A:274-385)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1919077Protein Suppressor of cytokine signaling 4, SOCS-4 [160564] (1 species)
  7. 1919078Species Human (Homo sapiens) [TaxId:9606] [160565] (1 PDB entry)
    Uniprot Q8WXH5 274-385
  8. 1919079Domain d2izva2: 2izv A:274-385 [145556]
    Other proteins in same PDB: d2izva1, d2izvb_, d2izvc_
    complexed with cl, edo, na

Details for d2izva2

PDB Entry: 2izv (more details), 2.55 Å

PDB Description: crystal structure of socs-4 in complex with elongin-b and elongin-c at 2.55a resolution
PDB Compounds: (A:) suppressor of cytokine signaling 4

SCOPe Domain Sequences for d2izva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]}
lvpdllqinnnpcywgvmdkyaaeallegkpegtfllrdsaqedylfsvsfrrysrslha
rieqwnhnfsfdahdpcvfhspditgllehykdpsacmffepllstplirtf

SCOPe Domain Coordinates for d2izva2:

Click to download the PDB-style file with coordinates for d2izva2.
(The format of our PDB-style files is described here.)

Timeline for d2izva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2izva1