Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Suppressor of cytokine signaling 4, SOCS-4 [160564] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160565] (1 PDB entry) Uniprot Q8WXH5 274-385 |
Domain d2izva2: 2izv A:274-385 [145556] Other proteins in same PDB: d2izva1, d2izva3, d2izvb_, d2izvc_ complexed with cl, edo, na |
PDB Entry: 2izv (more details), 2.55 Å
SCOPe Domain Sequences for d2izva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} lvpdllqinnnpcywgvmdkyaaeallegkpegtfllrdsaqedylfsvsfrrysrslha rieqwnhnfsfdahdpcvfhspditgllehykdpsacmffepllstplirtf
Timeline for d2izva2: