![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.22: ASF1-like [101546] (2 families) ![]() contains extra C-terminal strand automatically mapped to Pfam PF04729 |
![]() | Family b.1.22.1: ASF1-like [101547] (2 proteins) |
![]() | Protein Anti-silencing protein 1, ASF1 [101548] (3 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries) |
![]() | Domain d2huea1: 2hue A:2-164 [145410] Other proteins in same PDB: d2huea2, d2hueb1, d2hueb2, d2huec_ complexed with gol, so4, zn |
PDB Entry: 2hue (more details), 1.7 Å
SCOPe Domain Sequences for d2huea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2huea1 b.1.22.1 (A:2-164) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee lrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp
Timeline for d2huea1: