SCOP 1.75: Domain d2huea1: 2hue A:2-164

Lineage for d2huea1 (2hue A:2-164)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand

5. Family b.1.22.1: ASF1-like [101547] (1 protein)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)

8. Domain d2huea1: 2hue A:2-164 [145410]
   Other proteins in same PDB: d2huec1
   complexed with gol, so4, zn; mutant

Details for d2huea1

PDB Entry: 2hue, 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4

PDB Compounds: (A:) Anti-silencing protein 1

SCOP Domain Sequences for d2huea1:

Sequence; same for both SEQRES and ATOM records:

>d2huea1 b.1.22.1 (A:2-164) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp

Timeline for d2huea1:

• d2huea1 is new in SCOP 1.75
  
• d2huea1 appears in SCOPe 2.01
  
• d2huea1 appears in the current release, SCOPe 2.08