SCOP 1.75: Domain d2huec1: 2hue C:20-101

Lineage for d2huec1 (2hue C:20-101)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)

8. Domain d2huec1: 2hue C:20-101 [136776]
   Other proteins in same PDB: d2huea1
   automatically matched to d1p3gf_
   complexed with gol, so4, zn; mutant

Details for d2huec1

PDB Entry: 2hue, 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4

PDB Compounds: (C:) histone h4

SCOP Domain Sequences for d2huec1:

Sequence; same for both SEQRES and ATOM records:

>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfg

Timeline for d2huec1:

• d2huec1 first appeared in SCOP 1.73
  
• d2huec1 is called d2huec_ in SCOPe 2.01
  
• d2huec1 appears in the current release, SCOPe 2.08, called d2huec_