SCOPe 2.08: Domain d2h6ib1: 2h6i B:515-924

Lineage for d2h6ib1 (2h6i B:515-924)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
   Uniprot P49356

8. Domain d2h6ib1: 2h6i B:515-924 [145284]
   Other proteins in same PDB: d2h6ia1
   complexed with ger, zn; mutant

Details for d2h6ib1

PDB Entry: 2h6i, 3 Å

PDB Description: w102t/y365f protein farnesyltransferase double mutant complexed with a geranylgeranylated ddptasacvls peptide product at 3.0a

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2h6ib1:

Sequence; same for both SEQRES and ATOM records:

>d2h6ib1 a.102.4.3 (B:515-924) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrptlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcfclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

Timeline for d2h6ib1:

• d2h6ib1 first appeared in SCOP 1.75
  
• d2h6ib1 appears in SCOPe 2.07