Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-hexosaminidase A [160560] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries) Uniprot P06865 23-166 |
Domain d2gk1g2: 2gk1 G:23-166 [145217] Other proteins in same PDB: d2gk1a1, d2gk1b1, d2gk1b2, d2gk1c1, d2gk1d1, d2gk1d2, d2gk1e1, d2gk1f1, d2gk1f2, d2gk1g1, d2gk1h1, d2gk1h2 automatically matched to 2GJX A:23-166 complexed with ngt |
PDB Entry: 2gk1 (more details), 3.25 Å
SCOPe Domain Sequences for d2gk1g2:
Sequence, based on SEQRES records: (download)
>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf sqlvwksaegtffinkteiedfpr
>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi nkteiedfpr
Timeline for d2gk1g2: