Lineage for d2gk1h2 (2gk1 H:54-199)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1035255Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1035256Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 1035273Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
  7. 1035274Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
  8. 1035294Domain d2gk1h2: 2gk1 H:54-199 [135326]
    Other proteins in same PDB: d2gk1a1, d2gk1a2, d2gk1b1, d2gk1c1, d2gk1c2, d2gk1d1, d2gk1e1, d2gk1e2, d2gk1f1, d2gk1g1, d2gk1g2, d2gk1h1
    automatically matched to d1o7aa2
    complexed with ngt

Details for d2gk1h2

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (H:) beta-hexosaminidase beta chain

SCOPe Domain Sequences for d2gk1h2:

Sequence, based on SEQRES records: (download)

>d2gk1h2 d.92.2.1 (H:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d2gk1h2 d.92.2.1 (H:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOPe Domain Coordinates for d2gk1h2:

Click to download the PDB-style file with coordinates for d2gk1h2.
(The format of our PDB-style files is described here.)

Timeline for d2gk1h2: