![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Coagulation factor Xa, protease domain [50574] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50575] (49 PDB entries) Uniprot P00742 235-467 |
![]() | Domain d2gd4h1: 2gd4 H:16-244 [145194] Other proteins in same PDB: d2gd4a1, d2gd4c1, d2gd4i1, d2gd4l1 automatically matched to 2GD4 B:16-249 complexed with ca, nag, nto |
PDB Entry: 2gd4 (more details), 3.3 Å
SCOPe Domain Sequences for d2gd4h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gd4h1 b.47.1.2 (H:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdaggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Timeline for d2gd4h1: