Lineage for d2gd4h1 (2gd4 H:16-244)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Coagulation factor Xa, protease domain [50574] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50575] (58 PDB entries)
    Uniprot P00742 235-467
  8. Domain d2gd4h1: 2gd4 H:16-244 [145194]
    Other proteins in same PDB: d2gd4a1, d2gd4c1, d2gd4i1, d2gd4l1
    automatically matched to 2GD4 B:16-249
    complexed with ca, nag

Details for d2gd4h1

PDB Entry: 2gd4 (more details), 3.3 Å

PDB Description: crystal structure of the antithrombin-s195a factor xa-pentasaccharide complex
PDB Compounds: (H:) Coagulation factor, Stuart factor, Stuart-Prower factor, Contains: Factor X light chain; Factor X heavy chain; Activated factor Xa heavy chain

SCOPe Domain Sequences for d2gd4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd4h1 b.47.1.2 (H:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdaggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

SCOPe Domain Coordinates for d2gd4h1 are not available.

Timeline for d2gd4h1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gd4a1, d2gd4b1, d2gd4c1, d2gd4i1, d2gd4l1