SCOP 1.75: Domain d2gd4h1: 2gd4 H:16-244

Lineage for d2gd4h1 (2gd4 H:16-244)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Coagulation factor Xa, protease domain [50574] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50575] (75 PDB entries)
   Uniprot P00742 235-467

8. Domain d2gd4h1: 2gd4 H:16-244 [145194]
   Other proteins in same PDB: d2gd4a1, d2gd4c1, d2gd4i1, d2gd4l1
   automatically matched to 2GD4 B:16-249
   complexed with bma, ca, man, nag, nto; mutant

Details for d2gd4h1

PDB Entry: 2gd4, 3.3 Å

PDB Description: crystal structure of the antithrombin-s195a factor xa-pentasaccharide complex

PDB Compounds: (H:) Coagulation factor, Stuart factor, Stuart-Prower factor, Contains: Factor X light chain; Factor X heavy chain; Activated factor Xa heavy chain

SCOP Domain Sequences for d2gd4h1:

Sequence; same for both SEQRES and ATOM records:

>d2gd4h1 b.47.1.2 (H:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdaggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt

Timeline for d2gd4h1:

• d2gd4h1 is new in SCOP 1.75
  
• d2gd4h1 appears in SCOPe 2.01
  
• d2gd4h1 appears in the current release, SCOPe 2.08