SCOPe 2.06: Domain d2f43a2: 2f43 A:23-94

Lineage for d2f43a2 (2f43 A:23-94)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.0: automated matches [254232] (1 protein)
   not a true family

6. Protein automated matches [254527] (11 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255162] (1 PDB entry)

8. Domain d2f43a2: 2f43 A:23-94 [145132]
   Other proteins in same PDB: d2f43a1, d2f43a3, d2f43b1, d2f43b3, d2f43g1
   automated match to d1maba2
   complexed with adp, atp, mg, vo4

Details for d2f43a2

PDB Entry: 2f43, 3 Å

PDB Description: Rat liver F1-ATPase

PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2f43a2:

Sequence; same for both SEQRES and ATOM records:

>d2f43a2 b.49.1.0 (A:23-94) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndkli
kegdivkrtgai

Timeline for d2f43a2:

• d2f43a2 first appeared in SCOP 1.75
  
• d2f43a2 appears in SCOPe 2.05
  
• d2f43a2 appears in SCOPe 2.07
  
• d2f43a2 appears in the current release, SCOPe 2.08